Bacterial taxon 1314
Protein WP_002982921.1
30S ribosomal protein S14
Streptococcus pyogenes
Gene rpsN2, UniProt A0A4V6EEP0
>WP_002982921.1|Streptococcus pyogenes|30S ribosomal protein S14
MAKKSKIAKYQKQLQLIEQYADLRRDLKAKGDYESLRKLPRDSNPNRLKNRDKIDGRPHAYMRKFGVSRINFRDLAHKGQLPGVTKASW
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●●●●● 5.85 | 5.85012337392038 | 7.5e-69 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)