Bacterial taxon 1314
Protein WP_002983343.1
3-hydroxyacyl-ACP dehydratase FabZ
Streptococcus pyogenes
Gene fabZ, UniProt A0A4U7I770
>WP_002983343.1|Streptococcus pyogenes|3-hydroxyacyl-ACP dehydratase FabZ
MMDIREIQAALPHRYPMLLVDRVLEVSDDHIVAIKNVTINEPFFNGHFPHYPVMPGVLIMEALAQTAGVLELSKEENKGKLVFYAGMDKVKFKKQVVPGDQLVMTATFIKRRGTIAVVEARAEVDGKLAASGTLTFACGQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Macaque (Macaca fascicularis) | 9541 | Streptococcus pyogenes | 1314 | pathogen | Skeletal muscle tissue | 24 h | ●●●○○ -2.08 | -2.0806252511026 | 0.00078 | 32071274 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)