Bacterial taxon 373153
Protein WP_000565221.1
VOC family protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZNG2
>WP_000565221.1|Streptococcus pneumoniae D39|VOC family protein
MIDHFEIKVKDLQISEGFYRSFLAPLDYKLAFKTSSLISFLSPNSPHPGGDFWLTQGTQDPVHFAFLAENKEEVQACYEAGLEAGGRDNGVPGYRSEHPIYYAAFMIDLDGNNIEVVCHKE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.7 | -0.701495595610326 | 3.9e-13 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.49 | -0.494763953215196 | 2.5e-7 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.34 | -0.336892022969602 | 0.00057 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)