Bacterial taxon 373153
Protein WP_000892258.1
UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZMF1
>WP_000892258.1|Streptococcus pneumoniae D39|UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase
MLENGDLIFVRDGSDMGQAIQTSTGNYSHVAIYLDGMIYHASGQAGVVCQEPADFFESNHLYDLYVYPEMDIQSVKERACRHLGAPYNASFYPDAAGFYCSQYIAEILPIFETIPMKFGDGEQEISDFWREYYIELGLPVPLNQAGTNPSQLAASPLLQCKERNLHDSDF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.93 | -1.9327819630925 | 1.3e-31 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.42 | -1.41954765557525 | 1.5e-17 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.29 | -1.28749466573447 | 1.2e-14 | 27678244 | |
Retrieved 3 of 1 entries in 1.1 ms
(Link to these results)