Bacterial taxon 373153
Protein WP_000847060.1
UDP-N-acetylenolpyruvoylglucosamine reductase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZLY4
>WP_000847060.1|Streptococcus pneumoniae D39|UDP-N-acetylenolpyruvoylglucosamine reductase
MKTFLVKQKFRLGGERFAIKDDRGEIAYQVEGSFFKIPKTFTIYDAAGEQVSQISKEILTLLPRFEIQLRDGSSFVIRKKLTFWRDKYEFDNLGLRIEGNIWDLNFKLLDDRDQLIAEIKKELFHLTSTYTVTVLEDAYADLVISLCVAIDYVEMLESQSH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.33 | -2.33294268544157 | 4.8e-41 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.77 | -1.76699068601164 | 5.1e-24 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.61 | -1.60860897397314 | 4.7e-20 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)