Bacterial taxon 373153
Protein WP_001142534.1
tyrosine-protein kinase
Streptococcus pneumoniae D39
Gene cps2D, UniProt Q9ZII6
>WP_001142534.1|Streptococcus pneumoniae D39|tyrosine-protein kinase
MPTLEISQAKLDFVKKAEEYYNSLCTNLQLSGDGLKVFSITSVKLGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVMLGVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVSPNPTALLQRKNFSTMLETLRKYFDYIIVDTAPVGVVIDAAIITRKCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGVVLNKFDTSVDKYGSYGDYGKNKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.6 | -0.600995669933457 | 4.9e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.58 | -0.577915452066863 | 9.3e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.55 | -0.554079902970411 | 0.0002 | 27678244 | |
Retrieved 3 of 1 entries in 1.7 ms
(Link to these results)