Bacterial taxon 373153
Protein WP_000924721.1
Txe/YoeB family addiction module toxin
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZMD4
>WP_000924721.1|Streptococcus pneumoniae D39|Txe/YoeB family addiction module toxin
MLLKFTEDAWADYCYWQNQDKKTLKRINKLIKDIQRDPFTGIGKPEPLKYDYQGAWSRRIDAENRLIYMMDGDSVAFLSFKDHY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.1 | 2.09674920853705 | 1.3e-20 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.04 | 2.03895389538372 | 3.2e-19 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.86 | 1.85656511260853 | 3.3e-16 | 27678244 | |
Retrieved 3 of 1 entries in 1.3 ms
(Link to these results)