Bacterial taxon 373153
Protein WP_000390783.1
tRNA1(Val) (adenine(37)-N6)-methyltransferase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZPW4
>WP_000390783.1|Streptococcus pneumoniae D39|tRNA1(Val) (adenine(37)-N6)-methyltransferase
MEEEQLLKSGERINQLFSTDIKIIQNREVFSYSVDSVLLSRFPRFPKKGLIVDFCAGNGAVGLFASTRTQAQILSVEIQERLADMAERSVRLNGLEEQMQVICDDLKNMPAHIQGSKVDMILCNPPYFKVDPYSNLNESEHYLLARHEITTNLEEICHSAQSILKSNGRLAMVHRPDRLLDILDTLKRHNLAPKRLQFVYPKREKEANMLLIEAIKDGSTSGFKVLPPLIVHNDDGSYTPEIEEIYYGS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.33 | -1.33389733981183 | 1.5e-51 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.15 | -1.14632561750984 | 1.1e-38 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.73 | -0.728195416252234 | 1.5e-16 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)