Bacterial taxon 373153
Protein WP_000181383.1
tRNA (cytidine(34)-2'-O)-methyltransferase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZLI9
>WP_000181383.1|Streptococcus pneumoniae D39|tRNA (cytidine(34)-2'-O)-methyltransferase
MTNHIVLFEPQIPQNTGNIARTCAATNSPLHIIKPMGFPIDDRKMKRAGLDYWDKLEIYFYESLEDFMSQMKGKLYLISKFAEKVYSDVDLSTNEDHYFLFGREDKGLPEDFMREHPEKALRIPMNDEHVRSLNVSNTVCMIVYEALRQQNFAGLELVHTYEVDKLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.22 | -1.22006533642856 | 5.5e-14 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.06 | -1.06161151632281 | 3.1e-10 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.92 | -0.920989189528576 | 2.2e-8 | 27678244 | |
Retrieved 3 of 1 entries in 1.8 ms
(Link to these results)