Bacterial taxon 373153
Protein WP_000865694.1
tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZPI7
>WP_000865694.1|Streptococcus pneumoniae D39|tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB
MKVLAFDTSSKALSLAILEDKQVLAETTINIKKNHSITLMPAIDFLMASLDWTPKDLDRIVVAEGPGSYTGLRIAVATAKTLAHTLNIELVGMSSLLALVPYQQEGLFIPLMDARRNNVYAGFYENAKPVMAEAHLPFERVIELIKGASQVTFVGEVGPFVEQIQKHLPRTDYKETLPNAANLALLAWDKEADSLHDFVPNYLKRVEAEENWLKNHTESGESYIKRL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.37 | 0.366983140733328 | 0.0071 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.31 | -0.312603839384071 | 0.024 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.29 | -0.29346206073145 | 0.036 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)