Bacterial taxon 373153
Protein WP_001029883.1
translation initiation factor IF-1
Streptococcus pneumoniae D39
Gene infA, UniProt Q04ML4
>WP_001029883.1|Streptococcus pneumoniae D39|translation initiation factor IF-1
MAKDDVIEVEGKVVDTMPNAMFTVELENGHQILATVSGKIRKNYIRILAGDRVTVEMSPYDLTRGRITYRFK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.54 | -1.54416805877736 | 5.0e-28 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.92 | -0.917894251222588 | 1.2e-10 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.84 | -0.838995823428713 | 3.8e-9 | 27678244 | |
Retrieved 3 of 1 entries in 0.6 ms
(Link to these results)