Bacterial taxon 373153
Protein WP_000986386.1
transketolase family protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZL49
>WP_000986386.1|Streptococcus pneumoniae D39|transketolase family protein
MMRSTKELRHVYRDFLLEANQSSSDIVVLEADLSSSMATHNLEKDFGDRYVNVGIMEAEMVGLAAGLSIQGFRPYLHTFGPFSSRRVFDQLFISLGYAQLDATVIGSDAGVTAEMNGGTHMPFEEIGLLRLIPKSIIFEATDDIQFREILNQTLDLKGLKYIRTIRKAPEAVYQGGEDFSKGYIELRHGEDLVIVASGIMVAPSIRVADELSKLGYSVGVIDLFRIKPIPEQIKTMLSGKTIFTVENHNQIGGIGSALCELFSDDGITKIHRMGVQERFGQVGKMDYLLNEYGLSESNIKEKVLEIYNAR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.97 | 1.96576893663491 | 4.4e-72 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.58 | 1.58025175564208 | 2.4e-46 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.44 | 1.43801618789916 | 4.7e-38 | 27678244 | |
Retrieved 3 of 1 entries in 1.1 ms
(Link to these results)