Bacterial taxon 373153
Protein WP_000376736.1
transcription termination/antitermination protein NusG
Streptococcus pneumoniae D39
Gene nusG, UniProt A0A0H2ZN77
>WP_000376736.1|Streptococcus pneumoniae D39|transcription termination/antitermination protein NusG
MDSFDKGWFVLQTYSGYENKVKENLLQRAQTYNMLDNILRVEIPTQTVQVEKNGKRKEVEENRFPGYVLVEMVMTDEAWFVVRNTPNVTGFVGSHGNRSKPTPLLEQEIRDILVSMGQTVQEFDFDVEIGQTVRIIDGAFADYTGKITEIDNNKVKMIISMFGNDTVAEVNLNQIAEL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.61 | -0.606570859997512 | 1.9e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.48 | -0.481325955257687 | 0.00079 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.42 | -0.41584508954374 | 0.0037 | 27678244 | |
Retrieved 3 of 1 entries in 1.9 ms
(Link to these results)