Bacterial taxon 373153
Protein WP_000159176.1
transcription repressor NadR
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZND1
>WP_000159176.1|Streptococcus pneumoniae D39|transcription repressor NadR
MTKDRKQALLQLLKEAPKALNGQSLAEHFHVTRQVIVQDIAILRADGAPILSTNRGYIYKQIDTNPYVHKLFKVKHEVEEIGQELLAIVDNGGHVQNTLIDHPVYGEIETLLKLSCRRDVQHFLEQVEHSDFRPLSELTDGIHYHLVEAETQQDLHYIEEALDQLGYLVKD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.5 | 0.498009859656751 | 3.5e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.43 | 0.427927520009785 | 7.6e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.39 | 0.390455217700074 | 0.00028 | 27678244 | |
Retrieved 3 of 1 entries in 1.1 ms
(Link to these results)