Bacterial taxon 373153
Protein WP_001041071.1
TlyA family RNA methyltransferase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZPG8
>WP_001041071.1|Streptococcus pneumoniae D39|TlyA family RNA methyltransferase
MAKERVDVLAYKQGLFETREQAKRGVMAGLVVAVLNGERFDKPGEKIPDDTELKLKGEKLKYVSRGGLKLEKALQVFDLSVDGATTIDIGASTGGFTDVMLQNSAKLVFAVDVGTNQLAWKLRQDPRVVSMEQFNFRYAEKTDFEQEPSFASIDVSFISLSLILPALHRVLADQGQVVALVKPQFEAGREQIGKNGIIRDAKIHQNVLESVTAMAVEAGFSVLDLDFSPIQGGHGNIEFLAYLKKEKSASNQILAEIKEAVERAHSQFKNE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.14 | -1.14067550676926 | 4.3e-18 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.91 | -0.912831223756109 | 6.9e-12 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.75 | -0.749456529452119 | 1.9e-8 | 27678244 | |
Retrieved 3 of 1 entries in 2.1 ms
(Link to these results)