Bacterial taxon 373153
Protein WP_001029582.1
thioredoxin
Streptococcus pneumoniae D39
Gene trx, UniProt A0A0H2ZQR8
>WP_001029582.1|Streptococcus pneumoniae D39|thioredoxin
MAKAITDATFEQETKDGLVLVDFWATWCGPCRMQGPILDKLSEELSEDVLKIVKMDVDENPNTARAFGIMSIPTLLFKKDGQVVKQVAGVHTVEQIKAIIAELS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.26 | 1.26356073002951 | 3.2e-39 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.82 | 0.817913221998845 | 4.1e-17 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.47 | 0.468686485218297 | 2.1e-6 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)