Bacterial taxon 373153
Protein WP_000434650.1
thioredoxin
Streptococcus pneumoniae D39
Gene bta, UniProt A0A0H2ZQB3
>WP_000434650.1|Streptococcus pneumoniae D39|thioredoxin
MEQFLDNIKDLEVTTVVRAQEALDKKETATFFIGRKTCPYCRKFAGTLSGVVAETKAHIYFINSEEPSQLNDLQAFRSRYGIPTVPGFVHITDGQINVRCDSSMSAQEIKDFAGL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.2 | 2.20123915923213 | 8.5e-68 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.29 | 1.28562497622598 | 8.0e-24 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.25 | 1.25148810490593 | 1.2e-22 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)