Bacterial taxon 373153
Protein WP_000447993.1
thiol-disulfide oxidoreductase-associated membrane protein CcdA2
Streptococcus pneumoniae D39
Gene ccdA-2, UniProt A0A0H2ZPB6
>WP_000447993.1|Streptococcus pneumoniae D39|thiol-disulfide oxidoreductase-associated membrane protein CcdA2
METIVFLISVFLAGVLSFFSPCIFPLLPVYAGILLDDQESAKSFSLFGRKVLWSGLIRTLCFIAGISLIFFILGFGAGYFGHILYANWFRYVMGAIIIILGLHQMEIFHLKKLEVQKSFTFKKSDSNRYWSAFLLGITFSFGWTPCIGPVLSSVLALAASGGNGAWQGAIYTLIYTLGMALPFLVLALASGLVMPYFSKIKRHMMLLKKIGGFLIVLMGILLLLGQVNVLAGIFE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.97 | 0.968351715503873 | 4.3e-18 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.53 | 0.533527243975502 | 3.0e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.44 | 0.440653840687645 | 0.00013 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)