Bacterial taxon 373153
Protein WP_000757379.1
thiol-disulfide oxidoreductase-associated lipoprotein SdbB
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZRJ5
>WP_000757379.1|Streptococcus pneumoniae D39|thiol-disulfide oxidoreductase-associated lipoprotein SdbB
MKKVMFAGLSLLSLVVLMACGEEETKKTQAAQQPKQQTTVQQISVGKDVPDFTLQSMDGKEVKLSDFKGKKVYLKFWASWCGPCKKSMPELMELAAKPDRDFEILTVIAPGIQGEKTVEQFPQWFQEQGYKDIPVLYDTKATTFQAYQIRSIPTEYLIDSQGKIGKIQFGAISNADAEAAFKEMN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.02 | 1.02209755192761 | 3.3e-23 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.62 | 0.617386965240791 | 3.9e-9 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.38 | 0.381882348876327 | 0.00036 | 27678244 | |
Retrieved 3 of 1 entries in 1.1 ms
(Link to these results)