Bacterial taxon 373153
Protein WP_000105362.1
thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha
Streptococcus pneumoniae D39
Gene acoA, UniProt A0A0H2ZN82
>WP_000105362.1|Streptococcus pneumoniae D39|thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha
MSTLDKNLLLEMFRKMEEIRRMDLKIAQLVKKGKVPGMTHFSVGEEAANVGAMLALNPDDLITSNHRGHGQAIAKGIDLNGMMAEILGKYTGTCKGKGGSMHIADLDAGNLGANGIVGGGMGIAVGAALSQQMQNTGKIVVCFFGDGATNEGVFHEAVNMASIWNLPVIFYCINNGYGISADIKKMTNIEHIHQRSAAYGIPGMFIEDGNNVIDVYEGFQKAVDHVRSGNGPVLIESVTYRWLGHSSSDPGKYRTREEVELWKQKDPIENLRNYLIENNIASAEELEKIQAQVKEAVEASVKFAEESPFPPLESAFEDIYTD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1 | 1.00214330215157 | 1.3e-22 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.92 | 0.919575313944583 | 3.4e-19 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.61 | 0.605182152105149 | 4.3e-9 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)