Bacterial taxon 373153
Protein WP_000468585.1
thiamine phosphate synthase
Streptococcus pneumoniae D39
Gene thiE-1, UniProt A0A0H2ZQ09
>WP_000468585.1|Streptococcus pneumoniae D39|thiamine phosphate synthase
MFHKELLKLYFICGTTTCQGKNLYTVVEEALKGGITLFQFREKGESALEGLEKLELAIQIKELCKKYNVPFIVNDDIDLAMEIDADGVHVGQDDIGVDEIRKLMPDKIIGLSIRNEEEFQQSKVEYVDYVGVGPVFDTQSKDDAGGAIGYEGLELMRKLLPQMPLVAIGGIQTKHIKDIIKTNMDGVSIISAISYAKNIEKTVREMSEQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.51 | -1.50643215344592 | 2.7e-17 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.34 | -1.3366960953826 | 9.4e-14 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.12 | -1.11797260303434 | 5.0e-10 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)