Bacterial taxon 373153
Protein WP_000006154.1
thiamine diphosphokinase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZNV8
>WP_000006154.1|Streptococcus pneumoniae D39|thiamine diphosphokinase
MSEYKLSENNWTRVAVFAGGNRGHYRTDFDAFVGVDRGSLWVLEEDLPLALAVGDFDSVTEEERQVIQKRAQYFVQARPEKDDTDLELALLTIFEQNPQAQVTIFGALGGRIDHMLANVFLPSNPKLAPYMRQIEIEDGQNLIAYCSEGTSQLEPRSDYDYLAFMPVRDSQLTILGAKYELTEENFFFKKVYASNEYIDREVSVTCPDGYVVVLHSKDRR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.94 | -0.939403094027965 | 2.8e-19 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.7 | -0.699725278972707 | 1.9e-11 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.37 | -0.366579266118738 | 0.00048 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)