Bacterial taxon 373153
Protein WP_000168548.1
TfoX/Sxy family protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZR76
>WP_000168548.1|Streptococcus pneumoniae D39|TfoX/Sxy family protein
MASSKNYLEFVLEQLSGLDDVTYRSMMGEYILYFRGKIIGGIYDDRFLVKPVQAVLDKIDQSSFEFPYKGAKEMI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.81 | -0.807678083825078 | 4.3e-12 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.64 | -0.644901553530979 | 4.6e-8 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.58 | -0.580729249741687 | 9.0e-7 | 27678244 | |
Retrieved 3 of 1 entries in 2.2 ms
(Link to these results)