Bacterial taxon 373153
Protein WP_000813667.1
teichoic acid D-Ala incorporation-associated protein DltX
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZNF5
>WP_000813667.1|Streptococcus pneumoniae D39|teichoic acid D-Ala incorporation-associated protein DltX
MKQRKELYLFLGRTALYFLIFLGLLYFFSYLGQGQGSFIYNEF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.63 | 1.62861223681574 | 6.4e-9 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.39 | 1.38866629273973 | 8.8e-7 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.26 | 1.262271317832 | 7.4e-6 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)