Host taxon 9606
Protein NP_542763.1
sulfiredoxin-1
Homo sapiens
Gene SRXN1, UniProt Q9BYN0
>NP_542763.1|Streptococcus pneumoniae D39|sulfiredoxin-1
MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.62 | 1.61711146684286 | 7.9e-28 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.84 | -0.843874371142453 | 5.1e-8 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.75 | 0.745460926303308 | 5.7e-5 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)