Bacterial taxon 373153
Protein WP_000424424.1
SP_0115 family bacteriocin-like peptide
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZNL8
>WP_000424424.1|Streptococcus pneumoniae D39|SP_0115 family bacteriocin-like peptide
MELVLPNNYVDLEQEEMMYLDGGGVGRNWWNSRGSFATVLDVGLAIYSGGATIYSAYAIKKAISANRGAITRTLRSLIIKHVGSAAGHLVNTALNVALTVTGFSLGGAIAYGADWADGSLDGYIFA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.74 | 1.73751123445044 | 3.9e-14 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.51 | 1.50946243557169 | 4.9e-11 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.17 | 1.17466201741423 | 3.6e-7 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)