Bacterial taxon 373153
Protein WP_001151377.1
shikimate kinase
Streptococcus pneumoniae D39
Gene aroK, UniProt A0A0H2ZQ07
>WP_001151377.1|Streptococcus pneumoniae D39|shikimate kinase
MAKVLLGFMGAGKSTIARGLDPNYLDMDALIEKRLGMSIANFFAEKGEAAFRQVESEVLADLLQTDQVVSTGGGVVISQRNRDLLKTNTDNIYLKADFETLYLRIVADKDNQRPLFLNNSKEELVAIFQERQAWYEEVASRVLDVTKLSPEEIIEELR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.67 | 0.671987813028644 | 2.1e-8 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.49 | 0.488531071824928 | 6.2e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.37 | 0.372419671670747 | 0.0024 | 27678244 | |
Retrieved 3 of 1 entries in 1.7 ms
(Link to these results)