Bacterial taxon 373153
Protein WP_000133339.1
serine/threonine protein phosphatase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZPY2
>WP_000133339.1|Streptococcus pneumoniae D39|serine/threonine protein phosphatase
MTDYYVIGDVHGKAGMLEDLLKTWDGQTQLLFLGDLIDRGEDSHRVLEMVKDLVDNQGAICLSGNHEYMFLTWLDDPEESYDHYRRNGGDTTINSILGRPLDAPVDGVEDAKRVAAEAADLVEFIRQMPFVVETDKYIFVHAGIDLTLDDWHETTDYKKVWLRKPFHGAENHTGKTIVFGHTPVYGLLQQERGTSELWTTEDGKIGMDGGAVYGGVLHGIVFTDQGMTEHHFIENDGFVAED
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.85 | -1.85343430770214 | 2.1e-10 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.56 | -1.56472141139821 | 1.0e-7 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.15 | -1.14785586456716 | 0.00011 | 27678244 | |
Retrieved 3 of 1 entries in 0.7 ms
(Link to these results)