Bacterial taxon 373153
Protein WP_000041909.1
septum formation initiator family protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZNW1
>WP_000041909.1|Streptococcus pneumoniae D39|septum formation initiator family protein
MSKNIVQLNNSFIQNEYQRRRYLMKERQKRNRFMGGVLILIMLLFILPTFNLAQSYQQLLQRRQQLADLQTQYQTLSDEKDKETAFATKLKDEDYAAKYTRAKYYYSKSREKVYTIPDLLQR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.12 | -1.12497460271936 | 8.0e-22 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.89 | -0.894973586726039 | 4.2e-14 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.86 | -0.85998947585507 | 3.6e-13 | 27678244 | |
Retrieved 3 of 1 entries in 0.7 ms
(Link to these results)