Bacterial taxon 373153
Protein WP_000689596.1
S1 RNA-binding domain-containing protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZPW2
>WP_000689596.1|Streptococcus pneumoniae D39|S1 RNA-binding domain-containing protein
MKIGDKLKGRITGIQPYGAFVELETGDTGLIHISEIRTGFIENIHETLKVDEEVQVQVVDLDEFTGKASLSIRTLEEEKYQFPRRRRFSSDRFNYGFAPFRRMLPIWTGEALHHLKKKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.91 | -0.910596743487533 | 3.8e-18 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.88 | -0.881611557520591 | 4.8e-17 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.41 | -0.405938497599041 | 0.00013 | 27678244 | |
Retrieved 3 of 1 entries in 2 ms
(Link to these results)