Bacterial taxon 373153
Protein WP_000032550.1
S-ribosylhomocysteine lyase
Streptococcus pneumoniae D39
Gene luxS, UniProt Q04MC2
>WP_000032550.1|Streptococcus pneumoniae D39|S-ribosylhomocysteine lyase
MSKEVIVESFELDHTIVKAPYVRLIGEETGPKGDIISNYDIRLVQPNEDSIPTAGLHTIEHLLAKLIRTRIDGMIDCSPFGCRTGFHMIMWGRHTSAKIAAVIKDSLKEIAETTTWEDVPGTTIESCGNYKDHSLFSAKEWAKLILEQGISDDAFERHVI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.4 | -0.396784501570099 | 0.0039 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.35 | -0.350782426885291 | 0.011 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.31 | 0.314105414984406 | 0.022 | 27678244 | |
Retrieved 3 of 1 entries in 1.7 ms
(Link to these results)