Bacterial taxon 373153
Protein WP_001234978.1
RNA-binding S4 domain-containing protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZLU2
>WP_001234978.1|Streptococcus pneumoniae D39|RNA-binding S4 domain-containing protein
MRLDKYLKVSRIIKRRTVAKEVADKGRIKVNGILAKSSTDLKVNDQVEIRFGNKLLLVKVLEMKDSTKKEDAAGMYEIISETRVEENV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.34 | -1.34378501873641 | 3.2e-14 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.79 | -0.790505555022153 | 1.1e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.77 | -0.77026969897349 | 2.0e-5 | 27678244 | |
Retrieved 3 of 1 entries in 1.9 ms
(Link to these results)