Bacterial taxon 373153
Protein WP_000201898.1
RNA polymerase sigma factor RpoD
Streptococcus pneumoniae D39
Gene rpoD, UniProt A0A0H2ZQA1
>WP_000201898.1|Streptococcus pneumoniae D39|RNA polymerase sigma factor RpoD
MATKQKEVTTFDVQVAEFIRNHKQKGTATDDEINASLVIPFTLDADGIEDLLQRIQDAGISITDNEGNPSARVLSNEEEPELSDEDLIGSTSAKVNDPVRMYLKEIGVVPLLTNEEEKELALAVEAGDIEAKQRLAEANLRLVVSIAKRYVGRGMQFLDLIQEGNMGLMKAVDKFDYSKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLVREQRNLLQELGQDPTPEQIAERMDMTPDKVREILKIAQEPVSLETPIGEEDDSHLGDFIEDEVIENPVDYTTRIVLREQLDEILDTLTDREENVLRLRFGLDDGKMRTLEDVGKVFNVTRERIRQIEAKALRKLRQPSRSKPLRDFIED
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.82 | -0.818789767702223 | 8.1e-10 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.62 | -0.624989353578889 | 3.7e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.4 | 0.402898013188814 | 0.0031 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)