Bacterial taxon 373153
Protein WP_001003001.1
ribosome silencing factor
Streptococcus pneumoniae D39
Gene rsfS, UniProt A0A0H2ZMW6
>WP_001003001.1|Streptococcus pneumoniae D39|ribosome silencing factor
MNEKELLELVVKAADEKRAEDILALDVQDLTSVTDYFVITSSMNSRQLDAIAANIREKVAQAGFKGSHVEGDAAGGWVLLDLGAVVVHIFSEEMRAHYNLEKLWHEANSVDISEALA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.34 | -1.33654090335908 | 2.9e-31 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.76 | -0.762078607643934 | 2.2e-11 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.47 | -0.47433261794454 | 3.2e-5 | 27678244 | |
Retrieved 3 of 1 entries in 1.8 ms
(Link to these results)