Bacterial taxon 373153
Protein WP_000658498.1
rhomboid family intramembrane serine protease
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZQD4
>WP_000658498.1|Streptococcus pneumoniae D39|rhomboid family intramembrane serine protease
MKEIFDRRYPVTSFFLLVTALVFLLMLVTAGGNFDRADTLFRFGAMYGPAIRLFPEQVWRLLSAIFVHIGWEHFIVNMLSLYYLGRQVEEIFGSKQFFFLYLLSGMMGNLFVFVFSPKSLAAGASTSLYGLFAAIIVLRYATRNPYIQQLGQSYLTLFVVNIIGSVLIPGISLAGHIGGAVGGAFLAVIFPVRGEKRMYNTSQRLGAVVLFVGLAILLFYKGMGM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.65 | 1.64544385443577 | 3.5e-48 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.46 | 1.46149554335686 | 2.7e-38 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.27 | 1.27412146070208 | 1.4e-29 | 27678244 | |
Retrieved 3 of 1 entries in 0.6 ms
(Link to these results)