Bacterial taxon 373153
Protein WP_000259256.1
rhodanese-like domain-containing protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZLF6
>WP_000259256.1|Streptococcus pneumoniae D39|rhodanese-like domain-containing protein
MVTWILWALILAMLAWMGFNYLRIRRAAKIVDNEEFEALIRTGQLIDLRDPAEFHRKHILGARNIPSSQLKTSLAALRKDKPVLLYENQRAQRVTNAALYLKKQGFSEIYILSYGLDSWKGKVKTS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.28 | 1.28160875226768 | 4.4e-41 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.28 | 1.27515396673687 | 5.1e-41 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.21 | 1.20937957815381 | 1.5e-36 | 27678244 | |
Retrieved 3 of 1 entries in 1.1 ms
(Link to these results)