Bacterial taxon 373153
Protein WP_000776587.1
response regulator transcription factor
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZNR0
>WP_000776587.1|Streptococcus pneumoniae D39|response regulator transcription factor
MKLRIEIDGNLEETEIVIKTPTLTDEIADLQRLLQESKAPRLTFYKGTGEYYLDLSEILFFETEGSKIYAHNQKEAYEVRLKLYELEAILPRYFSRVSKSTIVNIRQIYSVDKSFSGTGTISFYQTHKEVHVSRHYQSLLKENLRNMR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.32 | 2.31921992365826 | 1.1e-76 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.73 | 1.72848780723677 | 2.2e-43 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.87 | 0.873342770895202 | 8.8e-12 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)