Bacterial taxon 373153
Protein WP_000548959.1
response regulator transcription factor
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZP68
>WP_000548959.1|Streptococcus pneumoniae D39|response regulator transcription factor
MHKILLIEDDQVIRQQIGKMLSEWGFEVVLVEDFMEVLSLFVQSEPHLVLMDIGLPLFNGYHWCQEIRKISKVPIMFLSSRDQAMDIVMAINMGADDFVTKPFDQQVLLAKVQGLLRRSYEFGRDESLLEYAGVILNTKSMDLHYQGQVLNLTKNEFQILRVLFEHAGNIVARDDLMRELWNSDFFIDDNTLSVNVARLRKKLEEQGLVGFIETKKGIGYGLKHA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.39 | 1.38676913775297 | 1.8e-21 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.21 | 1.21064634714039 | 5.8e-17 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.19 | 1.19000383699821 | 3.2e-16 | 27678244 | |
Retrieved 3 of 1 entries in 0.7 ms
(Link to these results)