Bacterial taxon 373153
Protein WP_000759279.1
redoxin family protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZR14
>WP_000759279.1|Streptococcus pneumoniae D39|redoxin family protein
MKKWQTCVLGAGSLLCLTACSGKSVTSEHQTKDEMKTEQTASKTSAAKGKEVADFELMGVDGKTYRLSDYKGKKVYLKFWASWCSICLASLPDTDEIAKEAGDDYVVLTVVSPGHKGEQSEADFKNWYKGLDYKNLPVLVDPSGKLLETYGVRSYPTQAFIDKEGKLVKTHPGFMEKDAILQTLKELS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.89 | 0.887653640954367 | 1.7e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.75 | 0.753952623489511 | 4.3e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.56 | 0.555094112494167 | 0.0026 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)