Bacterial taxon 373153
Protein WP_000737071.1
queuosine transporter QueT
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZLD5
>WP_000737071.1|Streptococcus pneumoniae D39|queuosine transporter QueT
MKKLTIRDVADIAIVAAIYVVLTVTPPLNAISYGAYQFRISEMMNFMAFYNPKYIIGVTIGCMIANFFSFGLLDVFVGGGSTLVFLSLGVWLFAKYSKDYLFNGLIRKDHFFFSILFSISMFTIAAELNIVAELPFFLTWFTTGIGEFASLIIGAIIIGKIGRRIDLSK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.81 | -2.80549156057058 | 2.4e-90 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ -2.21 | -2.21036719380723 | 2.1e-56 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ -2.02 | -2.01850203001168 | 3.0e-47 | 27678244 | |
Retrieved 3 of 1 entries in 1.8 ms
(Link to these results)