Bacterial taxon 373153
Protein WP_000156967.1
PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZMS0
>WP_000156967.1|Streptococcus pneumoniae D39|PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB
MTIVGCRIDGRLIHGQVANLWAGKLNVSRIMVVDDEVVNNDIEKSGLKLATPPGVKLSILPVEKAAANILAGKYDSQRLFIVARKPDRFLGLVEAGVPLETLNVGNMSQTPETRSITRSINVVDKDVEDFHKLAEKGVKLTAQMVPNDPISDFLSLLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.69 | -1.69490928846677 | 1.4e-9 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.59 | -1.58849830048505 | 4.7e-8 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.29 | -1.28923893856454 | 1.5e-6 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)