Bacterial taxon 373153
Protein WP_000912476.1
PTS sugar transporter subunit IIB
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZP18
>WP_000912476.1|Streptococcus pneumoniae D39|PTS sugar transporter subunit IIB
MLKIGTACGSGLGSSFMVQMNIESVLSDLNVSDVEVEHYDLGGADPNAADIWIVGRDLADSASHLGDVRILNSIIDMDELRELITKLCEEKGLI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.63 | 1.62792016119874 | 1.3e-15 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.27 | 1.26657288263758 | 1.2e-9 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.18 | 1.17791878654347 | 2.9e-8 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)