Bacterial taxon 373153
Protein WP_000238716.1
PTS sugar transporter subunit IIB
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZLA9
>WP_000238716.1|Streptococcus pneumoniae D39|PTS sugar transporter subunit IIB
MVKIGLFCAAGFSTGMLVNNMKIAAQASGVEAEIEAFSQSKLADYAPNIDVALLGPQVAYTLDKSKEICDKCDVPIAVIPMMDYGMLDGKKVLDLALSLISG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.15 | 2.1486788198223 | 3.0e-15 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.1 | 2.09646445968266 | 3.8e-15 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.74 | 1.73808982914176 | 1.9e-10 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)