Bacterial taxon 373153
Protein WP_000899623.1
PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZQQ8
>WP_000899623.1|Streptococcus pneumoniae D39|PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC
MLFTQALLVTLVGIIATIDYNGPLFMIHRPLVTSAMVGLVLGDFTQGVLIGSALELTWLGVTGIGGYTPPDTISGAIIGTAFGILSGQGETAGIAIAVPIAVATQQLDVLAKTLDVYFVKKADNDAKNGDYSKIGFYHYSSLVLITLFKIVPIFLAIMLGGEYVADLFAKVPPIVMQGLNSAGALLPSIGFGMLLNMMLKKNMWVFLLIGFICSVYGGMSTIGISLVGIAVAYFYDMIGSKPQETTSSSDVEEDLDL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.7 | 1.70399896611333 | 1.8e-14 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.53 | 1.52532568541181 | 2.2e-11 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.38 | 1.38198766146799 | 4.9e-9 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)