Bacterial taxon 373153
Protein WP_000185298.1
PTS mannose/fructose/sorbose transporter family subunit IID
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZKY1
>WP_000185298.1|Streptococcus pneumoniae D39|PTS mannose/fructose/sorbose transporter family subunit IID
MTNSNYKLTKEDFNQINKRSLFTFQLGWNYERMQASGYLYMILPQLRKMYGDGTPELKEMMKVHTQFFNTSPFFHTIIAGFDLAMEEKDGVGSKDAVNGIKTGLMGPFAPLGDTIFGSLVPAIMGSVAATMAIAGQPWGIFLWIAVAVAYDIFRWKQLEFAYKEGVNLINNMQSTLTALIDAASVLGVFMMGALVATVINFEISYKLPIGEKMIDFQDILNQIFPRLLPAIFTAFIFWLLGKKGMNSTKAIGIIIVLALALSALGHFALGM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.44 | -1.44184092489142 | 2.6e-13 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.96 | -0.955442486262436 | 1.6e-7 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.37 | -0.368713775585342 | 0.039 | 27678244 | |
Retrieved 3 of 1 entries in 1.3 ms
(Link to these results)