Bacterial taxon 373153
Protein WP_001078331.1
PTS lactose/cellobiose transporter subunit IIA
Streptococcus pneumoniae D39
Gene lacF-2, UniProt A0A0H2ZP74
>WP_001078331.1|Streptococcus pneumoniae D39|PTS lactose/cellobiose transporter subunit IIA
MNREEVTLLGFEIVAYAGDARSKLLEALKAAEAGDFEKADALVEEAGSCIAEAHHAQTSLLTKEASGEDLAYSVTMMHGQDHLMTTILLKDLMHHLIELYKRGVK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ -2.98 | -2.98030780578193 | 9.4e-10 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ -2.88 | -2.87867314690529 | 9.4e-9 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.34 | -2.34238427268731 | 5.5e-7 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)