Bacterial taxon 373153
Protein WP_000425250.1
PTS lactose/cellobiose transporter subunit IIA
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZP36
>WP_000425250.1|Streptococcus pneumoniae D39|PTS lactose/cellobiose transporter subunit IIA
MEMIVPDQIIMGLILYAGDAKQHIYKALDYIKNGTCERCEEEIQLADAALLEAHNLQTKFLAQEASGTKTEITALFVHSQDHLMTSMTEINLIKEIISLRKELHKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.07 | 2.07042791188408 | 3.3e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.96 | 1.96061203311421 | 8.9e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.59 | 1.59034031659157 | 0.00041 | 27678244 | |
Retrieved 3 of 1 entries in 0.6 ms
(Link to these results)