Bacterial taxon 373153
Protein WP_001070943.1
PTS cellobiose transporter subunit IIA
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZN30
>WP_001070943.1|Streptococcus pneumoniae D39|PTS cellobiose transporter subunit IIA
MNQEELQVAAFEIILHSGNARSEIHEAFAKMREGSFDDAESKLNQSNEIILEAHHAQTKLLQEYASGVEIKIEIIMVHAQDHLMTTMTLLEVAKEMLALYKKVN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.34 | 2.34474823209451 | 4.2e-36 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.14 | 2.14469070672392 | 1.9e-28 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.89 | 1.88869903402103 | 8.1e-23 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)