Bacterial taxon 373153
Protein WP_001256254.1
PspC domain-containing protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZNJ5
>WP_001256254.1|Streptococcus pneumoniae D39|PspC domain-containing protein
MRSGRDKKIAGVCAGVAHYLDMDPTIVRVIWGVLTCCYGAGIVAYIILWIIAPVATDY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.05 | -1.05219545582697 | 2.4e-23 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.97 | -0.974201886865945 | 2.6e-19 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.92 | -0.921570544698642 | 6.3e-18 | 27678244 | |
Retrieved 3 of 1 entries in 2 ms
(Link to these results)