Bacterial taxon 373153
Protein WP_000446519.1
primosomal protein DnaI
Streptococcus pneumoniae D39
Gene dnaI, UniProt A0A0H2ZP53
>WP_000446519.1|Streptococcus pneumoniae D39|primosomal protein DnaI
MESVGDVLKRQPSRFHYQDLVQKIMKDPDVAAFVQQESLNQDELNRSISKFNQYITERDKFLRGDTDYIAKGYKPILVMNHGYADVSYEETPELIAAEKEAAIKKRLNLINFPSSLKNVSFLDVYRDDVQRLTVLKRMIEFVNDYPNNLKGLYLYGDFGVGKSFMVAALAHDLSEKRGVSSTLLHYPSFVIDVKNAISDGNVKTLVDEIKLSEVLILDDIGAEQSTVWVRDEILQVILQYRMQENLPTFFTSNFNFEDLEKHFAKVKHGNDETWEARRVMERIRYLAEETRLEGVNRR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.62 | 0.62093859465567 | 7.3e-13 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.26 | 0.261142055654752 | 0.0035 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.21 | 0.205369943391073 | 0.023 | 27678244 | |
Retrieved 3 of 1 entries in 1.7 ms
(Link to these results)